DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG33462

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:278 Identity:57/278 - (20%)
Similarity:97/278 - (34%) Gaps:91/278 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PHQISLRR-----------------RGSHTCGGSIISKDYVVTAAHCVKQ--------------- 72
            ||.||.|.                 :|.| |.|::|:..:|:||||||..               
  Fly    32 PHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKT 95

  Fly    73 ----GNNVA--PANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNS 129
                .|::.  |..|..:..|..                |..||:|.  :|:.:|||...:.:.:
  Fly    96 KVDCDNHLCQEPFQEYNVDMGFR----------------HRYYNANDQTNDIGMLRLGRRVEYLN 144

  Fly   130 NIAAIKLAT----EDPPNDAT-VDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPET 189
            :|..|.:..    ::|.:..| ...:.|...:... .|..|..:.:....:|:|.:.|...:...
  Fly   145 HIRPICIFASNRFQEPIDQLTWFTTTVWRETAANA-TSKVLRTMNIDRQPKETCSEIYGWNMTFE 208

  Fly   190 TMCLLHPKDKGACYGDSGGPAT----YQGK----LVGLASFVIGGCGRAA--------PDGYERV 238
            .:|..:...: .|..|||.|..    :.|.    .:|:||.|.|.|..:.        .|..:||
  Fly   209 QICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRV 272

  Fly   239 SK-----------LRNWI 245
            .:           |:.|:
  Fly   273 VRQYGPSTDMNRSLKKWV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 56/276 (20%)
Tryp_SPc 28..248 CDD:238113 57/278 (21%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 48/242 (20%)
Tryp_SPc 48..269 CDD:214473 48/239 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.