DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Gzma

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:242 Identity:68/242 - (28%)
Similarity:117/242 - (48%) Gaps:31/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV--KQGNNVAPANELEIQAGSL 89
            ||:||........|:.:.|:.:....|.|::|:|::|:|||||:  |:...:..|:.::.:....
  Rat    28 RIIGGDTVVPHSRPYMVLLKLKPDSICAGALIAKNWVLTAAHCIPGKKSEVILGAHSIKKEPEQQ 92

  Fly    90 LLSSGGVRVPVATVTVHPNYNSNGH--DVAVLRLRNSLTFNSNIAAIKLAT--EDPPNDATVDIS 150
            :||       |.....:|.::.:.|  |:.:|||:...|.|.|:|.:.|..  :|........::
  Rat    93 ILS-------VKKAYPYPCFDKHTHEGDLQLLRLKKKATLNKNVAILHLPKKGDDVKPGTRCHVA 150

  Fly   151 GWGAISQRGPISNSLLYVQVKALSRESC--QKTY-------LRQLPETTMCLLHPK-DKGACYGD 205
            |||....:.|.|::|..|.:..:.|:.|  :|.|       |..:     |..:.: .|.:||||
  Rat   151 GWGRFHNKSPPSDTLREVNITVIDRKICNDEKHYNFNPVIGLNMI-----CAGNLRGGKDSCYGD 210

  Fly   206 SGGPATYQGKLVGLASFVI-GGCG-RAAPDGYERVS-KLRNWIAEKA 249
            ||||...:|...|:.:|.: |.|| ...|..|..:| |..:||.:.|
  Rat   211 SGGPLLCEGIFRGITAFGLEGRCGDPKGPGIYTLLSDKHLDWIRKTA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 65/236 (28%)
Tryp_SPc 28..248 CDD:238113 66/238 (28%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 65/236 (28%)
Tryp_SPc 29..256 CDD:238113 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.