DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and TPSG1

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:246 Identity:78/246 - (31%)
Similarity:110/246 - (44%) Gaps:44/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |||||..|..|.:|.|.|||.|..|.||||::|..:|:|||||.               :|||..
Human    62 RIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCF---------------SGSLNS 111

  Fly    92 SSGGVRVPVATVTVHPNYNS---------------NGHDVAVLRLRNSLTFNSNIAAIKL--ATE 139
            |...|.:....:|:.|::::               ...|:|::.|...:|.:|.|..:.|  |::
Human   112 SDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASD 176

  Fly   140 DPPNDATVDISGWGAISQRGPI--SNSLLYVQVKALSRESCQKTYLRQ----LPETTMCLLHPKD 198
            |........::|||...:..|:  ..||..|:|..:..|:|::.|...    |....:|...|.|
Human   177 DFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGD 241

  Fly   199 KGACYGDSGGPATYQ--GKLVGLASFVIG-GCGRA-APDGYERVSKLRNWI 245
              ||..|||||...|  |..|...:...| ||||. .|..|.||....|||
Human   242 --ACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/244 (31%)
Tryp_SPc 28..248 CDD:238113 77/245 (31%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 76/244 (31%)
Tryp_SPc 63..293 CDD:238113 77/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.