DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss2

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:255 Identity:76/255 - (29%)
Similarity:116/255 - (45%) Gaps:36/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK-- 71
            |.|..|.|....|.  :.:||||...:|...|:|:|| ..|.|.||||:|:..:||:||||.|  
  Rat     7 LALVGAAVAFPVDD--DDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCYKSR 68

  Fly    72 -------QGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTF 127
                   ...||...||..:.|              |.:..|||::..  .:|:.:::|.:.:..
  Rat    69 IQVRLGEHNINVLEGNEQFVNA--------------AKIIKHPNFDRKTLNNDIMLIKLSSPVKL 119

  Fly   128 NSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQKTYLRQLPETTM 191
            |:.:|.:.|.:...|......|||||.....|.....||. :....|.:..|:.:|..::.:..:
  Rat   120 NARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMV 184

  Fly   192 CL-LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDG---YERVSKLRNWIAE 247
            |: .....|.:|.||||||....|:|.|:.|:   |.|.|.||.   |.:|....:||.:
  Rat   185 CVGFLEGGKDSCQGDSGGPVVCNGELQGIVSW---GYGCALPDNPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/233 (30%)
Tryp_SPc 28..248 CDD:238113 71/236 (30%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 69/233 (30%)
Tryp_SPc 24..242 CDD:238113 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.