DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss1

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:252 Identity:76/252 - (30%)
Similarity:121/252 - (48%) Gaps:22/252 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV 70
            ::||:|...|.........:.:||||....|...|:|:|| ..|.|.||||:|:..:||:||||.
  Rat     2 SALLILALVGAAVAFPLEDDDKIVGGYTCPEHSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCY 65

  Fly    71 KQGNNVAPANELEIQAGS---LLLSSGGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSLTFNSN 130
            |        :.::::.|.   .:|......:..|.:..||||:|  ..:|:.:::|.:.:..|:.
  Rat    66 K--------SRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNAR 122

  Fly   131 IAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQKTYLRQLPETTMCL- 193
            :|.:.|.:...|......|||||.....|..:..||. |....||:..|:..|..::..:.:|: 
  Rat   123 VAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVG 187

  Fly   194 LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDG---YERVSKLRNWIAE 247
            .....|.:|.||||||....|:|.|:.|:   |.|.|.||.   |.:|.....||.:
  Rat   188 FLEGGKDSCQGDSGGPVVCNGQLQGIVSW---GYGCALPDNPGVYTKVCNFVGWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 70/227 (31%)
Tryp_SPc 28..248 CDD:238113 72/230 (31%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 70/227 (31%)
Tryp_SPc 24..242 CDD:238113 72/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.