DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG30098

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:252 Identity:70/252 - (27%)
Similarity:110/252 - (43%) Gaps:56/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG---S 88
            |::||..||  :.|....|.|.....||||:|:..:|:|||||.|..:|      |.::.|   |
  Fly    36 RVIGGQNAR--RTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDN------LFVRLGEYDS 92

  Fly    89 LLLSSGGVR-VPVATVTVHPNY-NSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDI-- 149
            ...:.|..| ..|.::..|.|| :...||:|||:|...:.:::.|..|.:............|  
  Fly    93 SRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQN 157

  Fly   150 ---SGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACYGDSGGPAT 211
               :|||.::....:..:|..:.::.:..|.|      .:|..::|..:|. :.||:||||||. 
  Fly   158 FTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC------GVPSLSICCWNPV-QYACFGDSGGPL- 214

  Fly   212 YQGKLV-----------GLASFVIGGCGRAAPDGYERV------------SKLRNWI 245
              |.||           |:.:.|.|.|     |||...            :.||||:
  Fly   215 --GSLVKYGHKTIYVQFGVTNSVTGNC-----DGYSSYLDLMSYMPWLYQTLLRNWV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/250 (28%)
Tryp_SPc 28..248 CDD:238113 69/251 (27%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 66/240 (28%)
Tryp_SPc 37..258 CDD:238113 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.