DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG30090

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:272 Identity:67/272 - (24%)
Similarity:107/272 - (39%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLCAAGVLAQNDSVVEPR-----------IVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYV 63
            |||:.|    |...:|||           |:||..|.....|....:.......|||::|::.:|
  Fly    15 VLCSLG----NGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFV 75

  Fly    64 VTAAHCVKQGNNVA--------PANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAV 118
            :||||||.:|:.|.        .|.|   ...|.:.........|.....|..::  .|.:|:|:
  Fly    76 LTAAHCVNEGSAVKVRLGEYDDTATE---DCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIAL 137

  Fly   119 LRLRNSLTFNSNIAAIKLATEDPPNDATVDI-----SGWGAISQRGPISNSLLYV-QVKALSRES 177
            |||...:||.::|:.|.:.......:....|     :|||  ..|...:..:|.: |::..:...
  Fly   138 LRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWG--ETRTHRTRGVLQITQLQRYNSSQ 200

  Fly   178 CQKTYLRQLPETTMCLLHPKDKGACYGDSGGP----ATYQGKL----VGLASFVIGGCGRAAPDG 234
            |.:...|.:.:..:| ........|.||||||    ..:..|:    .|:.|:....|.....  
  Fly   201 CMQALGRLVQQNQIC-AGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGV-- 262

  Fly   235 YERVSKLRNWIA 246
            |..|....:|||
  Fly   263 YTDVYSYADWIA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 57/252 (23%)
Tryp_SPc 28..248 CDD:238113 59/243 (24%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 56/241 (23%)
Tryp_SPc 40..276 CDD:238113 59/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12259
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.