DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG30031

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster


Alignment Length:262 Identity:106/262 - (40%)
Similarity:143/262 - (54%) Gaps:22/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPFWTSL-LVLCA------AGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSII 58
            ||.|...| .|.||      .|:|.|.|.    |||||:......||.||||:|.|||:|||||.
  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDG----RIVGGSATTISSFPWQISLQRSGSHSCGGSIY 61

  Fly    59 SKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRL 121
            |.:.:||||||::.    ..|:.|:|:|||...|||||...|::...|..||:|.  :|:|::::
  Fly    62 SSNVIVTAAHCLQS----VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKI 122

  Fly   122 RNSLTFNSNIAAIKLATEDPPNDATVDISGWGAISQ-RGPISNSLLYVQVKALSRESCQKT---Y 182
            ..:|||:|.|.||.||:.:|.|.|...:||||.:|. ...|.:.|.||.|..:|:..|..:   |
  Fly   123 NGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGY 187

  Fly   183 LRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            ..|:..|.:|.. ...|.||.||||||....|.|||:.|:..|......|..|..|:.||:|:..
  Fly   188 GSQIRSTMICAA-ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251

  Fly   248 KA 249
            .|
  Fly   252 NA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 93/223 (42%)
Tryp_SPc 28..248 CDD:238113 93/225 (41%)
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 93/223 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.