DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:268 Identity:83/268 - (30%)
Similarity:128/268 - (47%) Gaps:29/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSLLVLCAAGVLAQN-----DSVV--EPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYV 63
            |||.......||.|.     |.:.  |.||:||.:|..|.:|.|:||:....|.|||::||..:|
Mouse   157 TSLTDQDTENVLTQECGARPDLITLSEERIIGGMQAEPGDWPWQVSLQLNNVHHCGGALISNMWV 221

  Fly    64 VTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSLT 126
            :|||||.|.    .|..:.......:...|..:||.|..:..|..|:|  ..:|:||::|..|:.
Mouse   222 LTAAHCFKS----YPNPQYWTATFGVSTMSPRLRVRVRAILAHDGYSSVTRDNDIAVVQLDRSVA 282

  Fly   127 FNSNIAAIKL--ATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKT--YLRQLP 187
            |:.||..:.|  ||::....:...::|||:::..|....:|...:|:.:|.|.|...  |...:.
Mouse   283 FSRNIHRVCLPAATQNIIPGSVAYVTGWGSLTYGGNAVTNLRQGEVRIISSEECNTPAGYSGSVL 347

  Fly   188 ETTMCL-LHPKDKGACYGDSGGPATYQGK-----LVGLASFVIGG--CGRA-APDGYERVSKLRN 243
            ...:|. :......||.||||||...:..     :||:.|:   |  ||.. .|..|.||:..||
Mouse   348 PGMLCAGMRSGAVDACQGDSGGPLVQEDSRRLWFVVGIVSW---GYQCGLPNKPGVYTRVTAYRN 409

  Fly   244 WIAEKASL 251
            ||.::..:
Mouse   410 WIRQQTGI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/232 (31%)
Tryp_SPc 28..248 CDD:238113 74/234 (32%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:279699
Tryp_SPc 185..411 CDD:214473 73/232 (31%)
Tryp_SPc 186..414 CDD:238113 74/234 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.