DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss38

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:253 Identity:79/253 - (31%)
Similarity:124/253 - (49%) Gaps:31/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAP 78
            :|.:|....|::.:::||..||:.::|.|:||...|.|.|||||:|..:|::||||..:|..:  
Mouse    42 SGDVACGQPVLQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCFDRGKKL-- 104

  Fly    79 ANELEIQAGSLLLSSGGVRV---PVATVTVHPN---YNSNGHDVAVLRLRNSLTFNSNIAAIKLA 137
             ...:|..|...|.......   .:..|.:||.   |:..|.|||:::|::::.|:..:..|.| 
Mouse   105 -ETYDIYVGITNLEKANRHTQWFEIYQVIIHPTFQMYHPIGGDVALVQLKSAIVFSDFVLPICL- 167

  Fly   138 TEDPPNDA-TVDIS----GWGAISQRGPISNSLLYVQVKALSRESCQ-----KTYLRQLPETTMC 192
               ||:|. .:::|    |||.||.:|...|.||..|:..:.|..||     .:||  ||| .:|
Mouse   168 ---PPSDLYLINLSCWTTGWGMISPQGETGNELLEAQLPLIPRFQCQLLYGLSSYL--LPE-MLC 226

  Fly   193 LLHPKD-KGACYGDSGGPATYQGKLVGLASFVIG---GCGRAA-PDGYERVSKLRNWI 245
            ....|. |..|.||||.|...:.....|...::.   ||.:.. |..:..||...:||
Mouse   227 AADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 74/238 (31%)
Tryp_SPc 28..248 CDD:238113 76/239 (32%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 76/237 (32%)
Tryp_SPc 58..284 CDD:214473 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.