DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prtn3

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:263 Identity:83/263 - (31%)
Similarity:116/263 - (44%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PFWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISL---RRRGSHTCGGSIISKDYVV 64
            ||  .||.|...|      :|...:||||.:||....|:..||   |..|||.|||::|...:|:
Mouse    13 PF--LLLALVVGG------AVQASKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVL 69

  Fly    65 TAAHCVKQGNNVAPANELEIQ-------AGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLR 120
            |||||::         ::..|       |..||.|....:....:.....|||  .|.:||.:|:
Mouse    70 TAAHCLQ---------DISWQLVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLLLQ 125

  Fly   121 LRNSLTFNSNIAAIKLATEDPPNDATVD------ISGWGAISQRGPISNSLLYVQVKALSRESCQ 179
            |..:.:....:|...|    |..|.|:.      ..|||.:..:.|....|..:.|..:      
Mouse   126 LNRTASLGKEVAVASL----PQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVV------ 180

  Fly   180 KTYLRQLPETTMCLLHP-KDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAA-PDGYERVSKLR 242
             |:|.:  |..:|.|.| :..|.|:||||||....|.|.|:.||||..|.... ||.:.|||...
Mouse   181 -TFLCR--EHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYV 242

  Fly   243 NWI 245
            :||
Mouse   243 DWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 74/237 (31%)
Tryp_SPc 28..248 CDD:238113 76/238 (32%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 74/237 (31%)
Tryp_SPc 30..248 CDD:238113 76/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.