powered by:
Protein Alignment CG9676 and Y116A8A.6
DIOPT Version :9
Sequence 1: | NP_728008.1 |
Gene: | CG9676 / 32647 |
FlyBaseID: | FBgn0030773 |
Length: | 251 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_502994.2 |
Gene: | Y116A8A.6 / 190986 |
WormBaseID: | WBGene00013776 |
Length: | 448 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 18/71 - (25%) |
Similarity: | 23/71 - (32%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 PANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPP 142
||.|..:|..|...:|..........|..|. ::....||.|....|........|...|
Worm 343 PATEPLLQPESARTASSSASSKPEVQTTIPT------EIQTPSLRTSSLKTSTTVTTTTVTTTTP 401
Fly 143 NDATVD 148
:.||||
Worm 402 DPATVD 407
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9676 | NP_728008.1 |
Tryp_SPc |
27..245 |
CDD:214473 |
18/71 (25%) |
Tryp_SPc |
28..248 |
CDD:238113 |
18/71 (25%) |
Y116A8A.6 | NP_502994.2 |
DUF316 |
6..282 |
CDD:252150 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.