DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Y116A8A.6

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_502994.2 Gene:Y116A8A.6 / 190986 WormBaseID:WBGene00013776 Length:448 Species:Caenorhabditis elegans


Alignment Length:71 Identity:18/71 - (25%)
Similarity:23/71 - (32%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPP 142
            ||.|..:|..|...:|..........|..|.      ::....||.|....|........|...|
 Worm   343 PATEPLLQPESARTASSSASSKPEVQTTIPT------EIQTPSLRTSSLKTSTTVTTTTVTTTTP 401

  Fly   143 NDATVD 148
            :.||||
 Worm   402 DPATVD 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 18/71 (25%)
Tryp_SPc 28..248 CDD:238113 18/71 (25%)
Y116A8A.6NP_502994.2 DUF316 6..282 CDD:252150
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.