DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and T21E12.3

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_491364.2 Gene:T21E12.3 / 188700 WormBaseID:WBGene00020655 Length:346 Species:Caenorhabditis elegans


Alignment Length:248 Identity:51/248 - (20%)
Similarity:88/248 - (35%) Gaps:66/248 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLCAAGVLAQNDSVVEPRIVGG--TKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHC--- 69
            :.|..|:..:  |....:::.|  ||..:..:...|.:..:....|.|::||..:|:||.||   
 Worm    33 ITCGQGLKLK--SGYGRKVLNGLRTKIEDAPWNVAIEIETKDVGLCTGTLISTRHVITARHCFAH 95

  Fly    70 --------------------------VKQGNNVAPANELEIQAGS----------LLLSSGGVRV 98
                                      |..||   ..|...|..|:          :..:|.|:: 
 Worm    96 LMDYGYVSIGKNQLIHGCENDNDEDLVLHGN---LTNSFRIYTGTGCGYRKYCKGMNSTSVGIK- 156

  Fly    99 PVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDP---PNDATVDISGWG-----AI 155
            .:....|..:...:..|.|::.|..||..:.....|.:..||.   ..:..:.:.|:|     ..
 Worm   157 KIILPKVCDDKQLDFDDFAIVELSESLKMSRKDRFICVNHEDSNLFNENNRMQLFGFGIDPSAGN 221

  Fly   156 SQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACYGDSGG 208
            ...||:.:.    .|||   |.|..|..:.....::    .|::.||.|||||
 Worm   222 QSAGPLRSE----TVKA---EKCFTTTGKAFCTKSI----SKNQLACTGDSGG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 48/231 (21%)
Tryp_SPc 28..248 CDD:238113 48/230 (21%)
T21E12.3NP_491364.2 DUF316 16..313 CDD:367641 51/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.