DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and try-6

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001361988.1 Gene:try-6 / 185959 WormBaseID:WBGene00006624 Length:343 Species:Caenorhabditis elegans


Alignment Length:239 Identity:50/239 - (20%)
Similarity:91/239 - (38%) Gaps:62/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VEPRIVGGTKAREGQFPHQI---------SLRRRGSHTCGGSIISKDYVVTAAHCVK-------Q 72
            |:.:|..|.||...:.|..:         ::....|..|.|::.|..:::||.||..       .
 Worm    37 VKSKIFNGRKAEIDEAPWAVRINTYTNVKNIDETWSKHCSGTLTSPRHILTATHCAATYTETEWN 101

  Fly    73 GNNV-APANELEIQAGSLLLSSGGVR-VPVATVTVHP---------------NY-----NSNGH- 114
            |..: ||......:..|.|:    || |..:.:.|..               ||     :.|.: 
 Worm   102 GTVIDAPIYRKYCEEQSTLI----VREVAASRIVVRLRNRTEIGRAKYLFMFNYCRKIVDKNAYE 162

  Fly   115 -----DVAVLRLRNSLTFNSNIAAIKLA--TEDPPNDATVDISGWGAISQRG-PISNSLLY---- 167
                 |:.::.|...:.::|.:..:.:|  |:|...::.:|:.|:|....|. |.|...|:    
 Worm   163 IQYPDDIMIIELSEDVEYSSELKPVCVAGNTDDNAPNSHLDLFGFGDDPPRDKPSSLKNLHDIPL 227

  Fly   168 ----VQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACYGDSG 207
                |::..:::|...|   |..|...:.....:...||.||||
 Worm   228 KHHKVEIMDMNKEGTSK---RMDPRLFIAKSVTRTSVACPGDSG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 49/236 (21%)
Tryp_SPc 28..248 CDD:238113 49/235 (21%)
try-6NP_001361988.1 DUF316 7..320 CDD:367641 50/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.