DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Klk1b3

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_032719.1 Gene:Klk1b3 / 18050 MGIID:97322 Length:261 Species:Mus musculus


Alignment Length:265 Identity:76/265 - (28%)
Similarity:118/265 - (44%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTSLLVLCAAGVLAQNDSV--VEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAA 67
            |  .|:|..|..|...|:.  |:.|||||.|..:...|..:::.|...:.|||.::..::|:|||
Mouse     2 W--FLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAVYRYTQYLCGGVLLDPNWVLTAA 64

  Fly    68 HCVKQGNNV-APANEL---EIQAGSLLLSSGGVRVPVATVTVHPNYNSN-------------GHD 115
            ||......| ...|.|   |..|....:|..   :|      ||.:|.:             .:|
Mouse    65 HCYDDNYKVWLGKNNLFKDEPSAQHRFVSKA---IP------HPGFNMSLMRKHIRFLEYDYSND 120

  Fly   116 VAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGAIS-QRGPISNSLLYVQVKALSRESCQ 179
            :.:|||.........:..|.|.||:|...:|...||||:|: .:...::.|..|.:|.|..|.|.
Mouse   121 LMLLRLSKPADITDTVKPITLPTEEPKLGSTCLASGWGSITPTKFQFTDDLYCVNLKLLPNEDCA 185

  Fly   180 KTYLRQLPETTMCLLH-PKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRA-APDGYERVSKLR 242
            |.::.::.:..:|... ...|..|.||||||....|.|.|:.|:....||.. .|..|.:::|..
Mouse   186 KAHIEKVTDAMLCAGEMDGGKDTCKGDSGGPLICDGVLQGITSWGHTPCGEPDMPGVYTKLNKFT 250

  Fly   243 NWIAE 247
            :||.:
Mouse   251 SWIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/237 (28%)
Tryp_SPc 28..248 CDD:238113 68/240 (28%)
Klk1b3NP_032719.1 Tryp_SPc 25..256 CDD:238113 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.