DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Klk1b4

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:240 Identity:70/240 - (29%)
Similarity:105/240 - (43%) Gaps:45/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHC------VKQGNNVAPANELEIQAGS--LLLS 92
            |...|..:::.|...:.|||.::.:::|:|||||      |..|.|    |.||.:...  .|:|
Mouse    28 ENSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAHCYNDKYQVWLGKN----NFLEDEPSDQHRLVS 88

  Fly    93 SGGVRVPVATVTVHPNYNS---NGH----------DVAVLRLRNSLTFNSNIAAIKLATEDPPND 144
            ..   :|      ||::|.   |.|          |:.:|||.........:..|.|.||:|...
Mouse    89 KA---IP------HPDFNMSLLNEHTPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLG 144

  Fly   145 ATVDISGWGAISQRGPIS----NSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGA--CY 203
            :|...||||:.:   ||.    :.|..|.:|.|..|.|.|.:..::.:..:| ....|.|:  |.
Mouse   145 STCLASGWGSTT---PIKFKYPDDLQCVNLKLLPNEDCDKAHEMKVTDAMLC-AGEMDGGSYTCE 205

  Fly   204 GDSGGPATYQGKLVGLASFVIGGCGR-AAPDGYERVSKLRNWIAE 247
            .|||||....|.|.|:.|:....||. ..|..|.::.|..:||.|
Mouse   206 HDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/236 (28%)
Tryp_SPc 28..248 CDD:238113 70/240 (29%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 70/240 (29%)
Activation peptide homolog 18..24
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.