DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and F25E5.4

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001379698.1 Gene:F25E5.4 / 179133 WormBaseID:WBGene00017785 Length:425 Species:Caenorhabditis elegans


Alignment Length:283 Identity:54/283 - (19%)
Similarity:96/283 - (33%) Gaps:69/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVL-------CAAGVLAQNDSVVEPR---------IVGGTKAREGQFPHQISL-------RRR 48
            |||||       ||..:..:::.:::.:         .:.|..||.|..|..:|:       .:.
 Worm     4 SLLVLTILFTAVCAGKLDEKHNEILQLKCGIKGSQREFINGDTARPGDHPWAVSVYVKANTTSKN 68

  Fly    49 GSHTCGGSIISKDYVVTAAHCVK------------QGNNVAPANELEIQAGSL------------ 89
            |.....|::||..:|:| .:.:|            :.|.....|..|:....:            
 Worm    69 GVFLGPGTLISARHVLT-FNSIKVVDGKRRILGQEEVNGACNGNHFELSQDEMYHFDYDFEHFKN 132

  Fly    90 LLSSGGVRVPVATVTVHPNYNSNGHDVAVL--RLRNSLTFNSNIAAIKLATEDPPNDATVDISGW 152
            ..|....:..:|:|.:.....|:.....:|  .|:.|...|.....:.::......||: |...:
 Worm   133 FDSKRDFKNTIASVYIINGCQSSPPPATLLMFELKESALHNKKGYPVCISNSPKHFDAS-DFEVF 196

  Fly   153 GAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACYGDSGGPAT--YQGK 215
            |...|...:|.:.......|.:..||....             .:::|.|.||.||.|.  ...:
 Worm   197 GLNQQGRLVSGAFAPTNCTATAPFSCAHAV-------------KQNQGLCSGDFGGSAVSRIDNR 248

  Fly   216 LVGLASFVIG--GCGRAAPDGYE 236
            ...|..|..|  .| :|.|:..|
 Worm   249 FTMLGFFAQGNKNC-KAKPETLE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 47/256 (18%)
Tryp_SPc 28..248 CDD:238113 47/246 (19%)
F25E5.4NP_001379698.1 DUF316 5..291 CDD:367641 53/282 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.