DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Tpsb2

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:269 Identity:83/269 - (30%)
Similarity:129/269 - (47%) Gaps:37/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVV--EPR-------IVGGTKAREGQFPHQISLRRRGS---HTCGGSIISK 60
            ||:|.|..:||   |:|  .||       ||||.:|.|.::|.|:|||.:.:   |.||||:|..
Mouse     6 LLLLWALSLLA---SLVYSAPRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHP 67

  Fly    61 DYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNS--NGHDVAVLRLRN 123
            .:|:||||||  |.::.......:|.....|..|...:.:..:.|||:|.:  .|.|||:|.|..
Mouse    68 QWVLTAAHCV--GPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEV 130

  Fly   124 SLTFNSNIAAIKL--ATEDPPNDATVDISGWGAISQRGPI--SNSLLYVQVKALSRESCQKTYLR 184
            .:..::::..|.|  |:|..|...:..::|||.|....|:  ...|..|:|..:....|.:.|..
Mouse   131 PVNVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHT 195

  Fly   185 QL---------PETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIG---GCGRAAPDG-YE 236
            .|         .:..:|..:.: :.:|.||||||...:.|...|.:.|:.   ||.:....| |.
Mouse   196 GLYTGDDFPIVHDGMLCAGNTR-RDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYT 259

  Fly   237 RVSKLRNWI 245
            ||:...:||
Mouse   260 RVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 72/246 (29%)
Tryp_SPc 28..248 CDD:238113 73/240 (30%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842965
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.