DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Gzmm

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_032530.1 Gene:Gzmm / 16904 MGIID:99549 Length:264 Species:Mus musculus


Alignment Length:253 Identity:72/253 - (28%)
Similarity:120/253 - (47%) Gaps:18/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHC 69
            | |||:|.|...|....:..|.:|:||.:|.....|:..||::..||.|||.::.:.:|:|||||
Mouse     5 W-SLLLLLALKTLWAAGNRFETQIIGGREAVPHSRPYMASLQKAKSHVCGGVLVHRKWVLTAAHC 68

  Fly    70 VKQGNNVAPANELEIQAG--SLL-LSSGGVRVPVATVTVHPNYNSN-GHDVAVLRLRNSLTFNSN 130
            :.:     |...|::..|  :|. |...|:...:.....||.||.. .:|:|:|:|...:..:.|
Mouse    69 LSE-----PLQNLKLVLGLHNLHDLQDPGLTFYIREAIKHPGYNHKYENDLALLKLDRRVQPSKN 128

  Fly   131 IAAIKLATE---DPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKT--YLRQLPETT 190
            :..:.|..:   .|........:|||...|.||.:.:|..:.::.|..:.|..:  :...|.::.
Mouse   129 VKPLALPRKPRSKPAEGTWCSTAGWGMTHQGGPRARALQELDLRVLDTQMCNNSRFWNGVLIDSM 193

  Fly   191 MCL-LHPKDKGACYGDSGGPATY-QGKLVGLASFVIGGCGRA-APDGYERVSKLRNWI 245
            :|| ...|.:..|.||||||... :|::.|:.||....|... .|.....|:...:||
Mouse   194 LCLKAGSKSQAPCKGDSGGPLVCGKGQVDGILSFSSKTCTDIFKPPVATAVAPYSSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 62/229 (27%)
Tryp_SPc 28..248 CDD:238113 64/230 (28%)
GzmmNP_032530.1 Tryp_SPc 27..254 CDD:238113 64/230 (28%)
Tryp_SPc 27..251 CDD:214473 62/228 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.