DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Klk1b8

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_032483.1 Gene:Klk1b8 / 16624 MGIID:892018 Length:261 Species:Mus musculus


Alignment Length:264 Identity:67/264 - (25%)
Similarity:113/264 - (42%) Gaps:31/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAH 68
            |....|.|...|:.|.  ..::.|:|||....:...|.|:::.....|.|||.::.:::|:||||
Mouse     3 FLILFLALSLGGIDAA--PPLQSRVVGGFNCEKNSQPWQVAVYDNKEHICGGVLLERNWVLTAAH 65

  Fly    69 CVKQGNNVAPANELEIQAGSLLL----SSGGVRVPVATVTVHPNYNSN-------------GHDV 116
            |.        .::.|:..|...|    .|...|: |:....||.:|.:             .:|:
Mouse    66 CY--------VDQYEVWLGKNKLFQEEPSAQHRL-VSKSFPHPGFNMSLLTLKEIPPGADFSNDL 121

  Fly   117 AVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGAIS-QRGPISNSLLYVQVKALSRESCQK 180
            .:|||.........:..|.|.|::....:|...||||:|: .:....:.|..|.:|.|..::|.:
Mouse   122 MLLRLSKPADITDAVKPITLPTKESKLGSTCLASGWGSITPTKWQKPDDLQCVFLKLLPIKNCIE 186

  Fly   181 TYLRQLPETTMCLLHPK-DKGACYGDSGGPATYQGKLVGLASFVIGGCGR-AAPDGYERVSKLRN 243
            .:..::.:..:|..... .|..|.||||||......|.|:.|.....||: ..|..|..:.|..:
Mouse   187 NHNVKVTDVMLCAGEMSGGKNICKGDSGGPLICDSVLQGITSTGPIPCGKPGVPAMYTNLIKFNS 251

  Fly   244 WIAE 247
            ||.:
Mouse   252 WIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 60/237 (25%)
Tryp_SPc 28..248 CDD:238113 61/240 (25%)
Klk1b8NP_032483.1 Tryp_SPc 24..253 CDD:214473 60/237 (25%)
Tryp_SPc 25..256 CDD:238113 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.