DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Tmprss2

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_008766769.1 Gene:Tmprss2 / 156435 RGDID:620766 Length:580 Species:Rattus norvegicus


Alignment Length:240 Identity:81/240 - (33%)
Similarity:121/240 - (50%) Gaps:21/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSL 89
            :.|||||:.|..|.:|.|:||..:|.|.||||||:.:::|||||||::  .::........||.|
  Rat   251 QSRIVGGSTASPGDWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEE--PLSSPRYWTAFAGIL 313

  Fly    90 --LLSSGGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVD-- 148
              .|...|.|..|..|..||||:|  ..:|:|:::|:..|.||..:..:.|.......|...:  
  Rat   314 KQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDVVKPVCLPNPGMMLDLAQECW 378

  Fly   149 ISGWGAISQRGPISNSLLYVQVKALSRESCQKTYL--RQLPETTMC---LLHPKDKGACYGDSGG 208
            ||||||..::|..|:.|....|..:....|...|:  ..:....:|   |....|  :|.|||||
  Rat   379 ISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVD--SCQGDSGG 441

  Fly   209 P-ATYQGK---LVGLASFVIGGCGRA-APDGYERVSKLRNWIAEK 248
            | .|.:.:   |:|..|:. .||.:| .|..|..|:...:||.::
  Rat   442 PLVTLKNEIWWLIGDTSWG-SGCAKAYRPGVYGNVTVFTDWIYQQ 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 79/233 (34%)
Tryp_SPc 28..248 CDD:238113 80/235 (34%)
Tmprss2XP_008766769.1 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:292133
Tryp_SPc 253..482 CDD:214473 79/233 (34%)
Tryp_SPc 254..485 CDD:238113 80/235 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.