DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and PRSS36

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:253 Identity:80/253 - (31%)
Similarity:120/253 - (47%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EP--RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEI--- 84
            ||  |||||:.|:.|.:|.|:||...|.|.||||:|:..:|::||||......:.||.|..:   
Human    42 EPSARIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVLLG 106

  Fly    85 ---QAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKL--ATEDPP 142
               |.|.|   .|.....||.:.|..||:  ..|.|:|:|||.:..:....:..:.|  |:....
Human   107 VHSQDGPL---DGAHTRAVAAIVVPANYSQVELGADLALLRLASPASLGPAVWPVCLPRASHRFV 168

  Fly   143 NDATVDISGWGAISQRGPISNS--LLYVQVKALSRESCQKTY---------LRQLPETTMCLLHP 196
            :......:|||.:.:..|:...  |..|:::.|...:||..|         |:.|| ..:|..:|
Human   169 HGTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILP-GMLCAGYP 232

  Fly   197 KD-KGACYGDSGGPATYQ--GK--LVGLASFVIGGCGRA-APDGYERVSKLRNWIAEK 248
            :. :..|.||||||...:  |:  ..|:.||.. ||||. .|..:..|:....||.|:
Human   233 EGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGF-GCGRRNRPGVFTAVATYEAWIREQ 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/244 (31%)
Tryp_SPc 28..248 CDD:238113 76/246 (31%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 75/244 (31%)
Tryp_SPc 47..289 CDD:238113 76/246 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.