DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP001198

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_321961.2 Gene:AgaP_AGAP001198 / 1281971 VectorBaseID:AGAP001198 Length:260 Species:Anopheles gambiae


Alignment Length:245 Identity:70/245 - (28%)
Similarity:117/245 - (47%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VEPRIVGGTKAREGQFPHQISLR------RRGSHTCGGSIISKDYVVTAAHCVKQGNN------V 76
            :.|.|:.||:|...:||:|:||:      .|..|.|.||||::.:::|||||:::...      |
Mosquito    19 IRPPIIEGTEANLHEFPYQVSLQWNFNNGSRARHFCSGSIINQRWILTAAHCLEEYTKDGWFEVV 83

  Fly    77 APANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATE 139
            |..|.:..:      .:|..|..|.....|.:|:.:.  :|:.||:|.:.|....||..::|||:
Mosquito    84 AGVNNIAHE------EAGAQRRNVTRYEQHESYDLSAIRYDIGVLQLSHPLDLTRNIKTMRLATK 142

  Fly   140 DP-PNDATVDISGWGAISQ--RGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGA 201
            |. .:......:|||:||:  .....:.|:.|.:...:.|.||.  :.::.||.:|....|:...
Mosquito   143 DTLIHQKIAKFAGWGSISKTWEDIYPDKLMKVNLILRTEEDCQT--IGKIDETQICAGGYKNVSG 205

  Fly   202 CYGDSGGPATY----QGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            |..|||||.|.    :...:|:.|:....|....|..|..|....:||.:
Mosquito   206 CTADSGGPLTVTIDGEQMQIGVLSYGEKPCQARLPIVYSSVMYFHDWIQD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/238 (28%)
Tryp_SPc 28..248 CDD:238113 69/241 (29%)
AgaP_AGAP001198XP_321961.2 Tryp_SPc 23..255 CDD:238113 69/239 (29%)
Tryp_SPc 23..253 CDD:214473 67/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.