DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP001199

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_321960.2 Gene:AgaP_AGAP001199 / 1281970 VectorBaseID:AGAP001199 Length:268 Species:Anopheles gambiae


Alignment Length:271 Identity:85/271 - (31%)
Similarity:129/271 - (47%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLR-------RRGSHTCGGSIISKDYVV 64
            :|.|:.||.|.|:..   .|:||||.:|...:||:||||:       :...|.||||:|::.:|:
Mosquito     9 ALAVVLAALVAAKPS---RPKIVGGEEAIAHEFPYQISLQWNYNNDEQDPFHFCGGSLIAEKFVL 70

  Fly    65 TAAHCVKQGNNVAPANELEIQAGSLLLS---SGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNS 124
            ||.|||...  ::|....|..||....|   :|..|..:|.:.||.:|..:  .:|:|:.|:...
Mosquito    71 TAGHCVPSA--ISPDGFPEAVAGEHDFSQYDAGVQRRRIAEMYVHEDYEGSVGPNDIAIFRVDKP 133

  Fly   125 LTFNSNIAAIKLATED--PPNDATVDISGWG--AISQRGPISNSLLYVQVKALSRESCQKTYLRQ 185
            ...|.||..:.|...:  |..:.|  |||||  :.|......|.|:...:..:..|.|:|.|..:
Mosquito   134 FHLNRNIQLVTLPEPNAIPTGETT--ISGWGSTSFSFEPSYPNILMKTTLPIMDLEVCRKIYFTE 196

  Fly   186 -LPETTMCL-LHPKDKGACYGDSGGPATY---QGKLVGLASFVIGG--CGRAAPDGYE------R 237
             :.::.:|. ........|.||||||...   :...||:.|:  ||  ||     ||:      |
Mosquito   197 TVADSNICAGTMEGTSSVCSGDSGGPLVQIDDEIVQVGIVSW--GGIPCG-----GYKNPGVFVR 254

  Fly   238 VSKLRNWIAEK 248
            ||...:||.:|
Mosquito   255 VSYFIDWINDK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/246 (30%)
Tryp_SPc 28..248 CDD:238113 77/248 (31%)
AgaP_AGAP001199XP_321960.2 Tryp_SPc 26..262 CDD:214473 75/246 (30%)
Tryp_SPc 27..265 CDD:238113 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.