DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP001246

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_321901.4 Gene:AgaP_AGAP001246 / 1281921 VectorBaseID:AGAP001246 Length:283 Species:Anopheles gambiae


Alignment Length:281 Identity:90/281 - (32%)
Similarity:135/281 - (48%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPFWTSLLVLCAAGVLA----------QNDSVVEP----------RIVGGTKAREGQFPHQISL 45
            ::|....||.||.|||.:          |......|          ||||||:..| ..|:.:||
Mosquito     9 VVPAGLVLLALCVAGVWSNEAQDAWASRQRRVQATPNGDGQKKFSGRIVGGTELTE-PLPYLLSL 72

  Fly    46 RRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLS--SGGVRVPVATVTVHPN 108
            |..|.|.||.|||:..:.::||||....::|   |.|.:.||....:  :.|:...||.||.||:
Mosquito    73 RDSGFHICGASIINAKHALSAAHCQSPPSDV---NRLTLLAGITKRTDETNGILFKVANVTTHPD 134

  Fly   109 YNSNGH--DVAVLRLRNSLTFNSNIAAIKL--ATEDPPNDATVDISGWGAISQRGPISNSLLYVQ 169
            ::...:  |||::|:..|...:.|:|||.|  .|......:...:||||..:|...::.:|..|:
Mosquito   135 FSLKTYLSDVAIIRIVTSFLDHPNLAAIPLISTTYKLRVSSVASVSGWGLTAQDSMLAPTLRTVR 199

  Fly   170 VKALSRESCQKTYLRQLP--ETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAP 232
            :..:|..||...: |.:|  .|.:|..|| .:.:|.||||||....|..:||.|:....||...|
Mosquito   200 IPIVSYSSCVNKW-RPVPIVWTAICAGHP-GRDSCNGDSGGPLVQDGVQIGLVSWGADRCGSDYP 262

  Fly   233 DGYERV--SKLRNWIAEKASL 251
            ..|..|  ..:|.:|.|.:.:
Mosquito   263 GIYTYVGNKNIRKFIEENSGV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 78/227 (34%)
Tryp_SPc 28..248 CDD:238113 78/229 (34%)
AgaP_AGAP001246XP_321901.4 Tryp_SPc 55..270 CDD:214473 77/220 (35%)
Tryp_SPc 56..270 CDD:238113 76/219 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.