DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP001366

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_321777.4 Gene:AgaP_AGAP001366 / 1281814 VectorBaseID:AGAP001366 Length:563 Species:Anopheles gambiae


Alignment Length:268 Identity:63/268 - (23%)
Similarity:112/268 - (41%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRG----SHTCGGSIISKDYVVTAAHCVK 71
            :|...|...|     |.:..||.:..||||...:|.|..    .:.||.::||:...:||||||.
Mosquito   303 ICGTVVPKAN-----PLVTHGTVSERGQFPWHGALYRSTVTELKYLCGATLISRRASITAAHCVT 362

  Fly    72 QGNNVAPANELEIQAGSLLLSSGGVRV----------PVATVTVHPNYNSNG--HDVAVLRLRNS 124
            ...:..|     :.||||||..|.:.:          .:.::.:...|....  :|:|||.|:..
Mosquito   363 LEKSSKP-----VDAGSLLLYFGKIDLSKWNGPEEDAQIRSIHIPAQYQHERFFNDIAVLVLKED 422

  Fly   125 LTFNSNIAAIKLATEDPPNDATVD----ISGWGAISQRGPISNSLLYVQVKALSRESC----QKT 181
            :.:::.:..:.|...|......::    :.||| .::.|.:|:.|.:.|:..::.|:|    :..
Mosquito   423 IKYSNFVRPVCLWNFDDDYKTLINKIGFVPGWG-YNEHGLVSSRLSFAQMPVVAHETCIWSNRDF 486

  Fly   182 YLRQLPETTMCLLHPKDKGACYGDSGGPATYQGK----LVGLASFVIGGCGRAAPDG-----YER 237
            :.:...:|:.|.........|.|||||...::..    |.|:.|.......|...|.     :..
Mosquito   487 FSKVTSDTSFCAGFKNGTSVCNGDSGGGMVFKHNNLWYLRGIVSVSAALQDRFHCDSKHYVVFTD 551

  Fly   238 VSKLRNWI 245
            .:|..:||
Mosquito   552 AAKFTSWI 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 57/250 (23%)
Tryp_SPc 28..248 CDD:238113 59/251 (24%)
AgaP_AGAP001366XP_321777.4 GD_N 15..124 CDD:292649
Tryp_SPc 315..560 CDD:238113 59/251 (24%)
Tryp_SPc 315..559 CDD:214473 57/249 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.