DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP001395

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_321740.5 Gene:AgaP_AGAP001395 / 1281782 VectorBaseID:AGAP001395 Length:268 Species:Anopheles gambiae


Alignment Length:257 Identity:79/257 - (30%)
Similarity:119/257 - (46%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQG-NNVAPANELEIQAGS 88
            :.|||||..:..||..:..||.:||.|.||.||::..:::||.|||..| |.:..||:::...|.
Mosquito     9 QQRIVGGVNSNRGQITYIASLTKRGGHFCGASIVNDRWLLTAGHCVCSGVNKILRANQIQAVLGL 73

  Fly    89 LLLSSGG-------------VRVPVATVTVHPNY--NSNGHDVAVLRLRNSLTFNSNIAAIKLAT 138
            ...|..|             ..|.:.|:..||.|  |...:|:|:|.|...:.|::::..|.|::
Mosquito    74 YRRSEFGGNQIDSDPFSDRAYEVGIRTIVPHPGYVCNKPSNDIALLELARRIDFSASVRPICLSS 138

  Fly   139 EDPPNDATVD-----ISGWGAISQR---GPISNSLLYVQVKALSRESCQKTY-----LRQLPETT 190
             .....|.|:     ::|||...:.   |..:::|....|.....|.|:..|     .|.:..|.
Mosquito   139 -GADGSARVEGQTAVVAGWGWQQENRNLGDKADTLQRAVVDVFRNEECESMYRRGNRSRTIARTQ 202

  Fly   191 MCLLHPKDKG-----ACYGDSGGP-ATYQGKLVGLASFVIGGCGRAA-PDGYERVSKLRNWI 245
            :|    ..||     ||:.||||| .|....|:|:.|..| ||.|.. |..|.|||:..:||
Mosquito   203 LC----AGKGTGGVDACWADSGGPLVTSDNVLIGIVSTGI-GCARPGFPGIYTRVSEYASWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 77/253 (30%)
Tryp_SPc 28..248 CDD:238113 78/254 (31%)
AgaP_AGAP001395XP_321740.5 Tryp_SPc 11..259 CDD:214473 77/253 (30%)
Tryp_SPc 12..259 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.