DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CLIPD3

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_321698.4 Gene:CLIPD3 / 1281744 VectorBaseID:AGAP001433 Length:670 Species:Anopheles gambiae


Alignment Length:265 Identity:76/265 - (28%)
Similarity:114/265 - (43%) Gaps:43/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSVVEP-----------RIVGGTKAREGQFPHQISL----RRRGSHTCGGSIISKDYVVTAAHCV 70
            |::|:|           |||||.:|..||:|...::    .:|....||||:|...|::|||||.
Mosquito   407 DNIVDPDDCGQQEYSSGRIVGGIEAPTGQWPWMAAIFLHGTKRTEFWCGGSLIGTKYILTAAHCT 471

  Fly    71 KQGNNVAP--ANELEIQAGSLLLSSGG-----VRVPVATVTVHPNYNSNG--HDVAVLRLRNSLT 126
            :.... .|  |.:..::.|.:.||:.|     |...|..|..||.::..|  :|:|:|.|...:.
Mosquito   472 RDSRQ-RPFAARQFTVRLGDIDLSTDGEPSAPVTYKVTEVRAHPRFSRVGFYNDIALLVLDKPVR 535

  Fly   127 FNSNIAAIKLATEDPPND-------ATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLR 184
            .:..:..:.|...:.|:.       |||  .|||.....|..|.......:.....|.|.:.|.:
Mosquito   536 KSKYVIPVCLPGPNLPSKERLAGRRATV--VGWGTTYYGGKESTKQQQATLPVWRNEDCNRAYFQ 598

  Fly   185 QLPETTMCL-LHPKDKGACYGDSGGP----ATYQGKLVGLASFVIGG-CGRAA-PDGYERVSKLR 242
            .:.:..:|. .......||.||||||    ...:...||:.||  |. ||... |..|.|:|:..
Mosquito   599 PITDNFVCAGFSEGGVDACQGDSGGPLMMLVEARWTQVGVVSF--GNKCGEPGYPGVYTRISEYM 661

  Fly   243 NWIAE 247
            .||.|
Mosquito   662 EWIRE 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 70/244 (29%)
Tryp_SPc 28..248 CDD:238113 72/247 (29%)
CLIPD3XP_321698.4 CLIP 292..335 CDD:197829
Tryp_SPc 424..664 CDD:214473 70/244 (29%)
Tryp_SPc 425..667 CDD:238113 72/247 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.