DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG43336

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:260 Identity:74/260 - (28%)
Similarity:102/260 - (39%) Gaps:49/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPFWTSLLVL-CAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRR-GSHTCGGSIISKDYV 63
            :||...|...| .|.|:.|.:.||  ||:..||.|.....|....|... |...||||:|:...|
  Fly    12 LLPLLGSTQFLDMACGIRAHSPSV--PRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLV 74

  Fly    64 VTAAHC-VKQGNNVAPANELEIQAGSLLLSS-----------GGVRVPVATVTVHPNYN--SNGH 114
            :||||| :.:...||...|.:.:...:...|           .|.|        |.:||  :..:
  Fly    75 LTAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFR--------HRHYNPMTMAY 131

  Fly   115 DVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDI------SGWGAISQRGPISNSLLYVQVKAL 173
            |:|:|||...:.:..||..|.:.. ||.....:|.      :|||.....|. |..|..|.:...
  Fly   132 DIAILRLYRKVQYTDNIRPICIVI-DPRWRKYIDSLDPLTGTGWGKTESEGD-SAKLRTVDLARK 194

  Fly   174 SRESCQKTYLRQLPETTMCLLHPKDKGACYGDSGGPATYQGKL-----------VGLASFVIGGC 227
            ..|.|::.....|.....|..:.: ...|.||||||.   |.|           ||:|||....|
  Fly   195 HPEVCRRYATLSLTANQFCAGNER-SNLCNGDSGGPV---GALIPYGKSKRFVQVGIASFTNTQC 255

  Fly   228  227
              Fly   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 64/233 (27%)
Tryp_SPc 28..248 CDD:238113 63/232 (27%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 64/233 (27%)
Tryp_SPc 40..271 CDD:238113 63/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.