DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP003971

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_318423.5 Gene:AgaP_AGAP003971 / 1278791 VectorBaseID:AGAP003971 Length:263 Species:Anopheles gambiae


Alignment Length:231 Identity:82/231 - (35%)
Similarity:133/231 - (57%) Gaps:19/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLL 90
            |||.||..|.:||||.|::|...|...|||:::::.:::|||.|: .|..:   :::::..||..
Mosquito    35 PRIAGGEDAADGQFPFQVALINEGLVYCGGTVVNRRWILTAAACI-TGKAL---SDVQLFVGSAD 95

  Fly    91 LSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSN-IAAIKLATE--DPPNDATVDIS 150
            ..:||..|......:||::|:.  .:|:|::|:..||.|..| :..|:|||:  :...:|||  |
Mosquito    96 RLTGGRNVTAERFVIHPDFNAQTYANDIALVRMAESLAFTGNELQPIRLATDFFETATNATV--S 158

  Fly   151 GWG--AISQRGPISNSLLYVQVKALSRESC----QKTYLRQLPETTMCLLHPKDKGACYGDSGGP 209
            |||  ||| ...:.|.|.:::...:..|.|    ::.|..::.:.|:|..:..::|.|.||:|||
Mosquito   159 GWGRFAIS-NNQLPNRLQFIRTDVIGSEDCAEQFEEPYRSRISDRTICTSNQANQGVCLGDAGGP 222

  Fly   210 ATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            ....|:|||:.|:.| .||...||.|||||..|.||
Mosquito   223 LVLDGELVGVQSWSI-PCGTGLPDVYERVSHHRAWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 79/228 (35%)
Tryp_SPc 28..248 CDD:238113 80/229 (35%)
AgaP_AGAP003971XP_318423.5 Tryp_SPc 36..257 CDD:214473 79/228 (35%)
Tryp_SPc 37..257 CDD:238113 78/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.