DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP006486

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_316523.4 Gene:AgaP_AGAP006486 / 1277090 VectorBaseID:AGAP006486 Length:287 Species:Anopheles gambiae


Alignment Length:267 Identity:78/267 - (29%)
Similarity:128/267 - (47%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAG---VLAQNDSVVE---PRIVGGTKAREGQFPHQISL---RRRGSHTCGGSIISKDYV 63
            ||....:|   :||:.:...|   |.|.|||.|..||||..:::   ....:..|||.|:::::|
Mosquito    15 LLATTVSGQRYMLAEQEEGYEPFLPFIAGGTNAVNGQFPSIVAVGLPAPPNNAFCGGVILNENHV 79

  Fly    64 VTAAHCV-KQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSL 125
            :|||.|| ...|.:..||:|.|.:|.|.|:.|..|:.:..|.|||.||  :..|::||||..::.
Mosquito    80 LTAARCVLTPQNTLLFANQLNILSGMLQLNFGAPRIGITAVYVHPQYNPFTFEHNIAVLRTSSNF 144

  Fly   126 TF------NSNIAAI--KLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQ--K 180
            .|      |.:.|..  ::|.:..|    ..:.||    ..|..:....::....|:|::|.  .
Mosquito   145 FFPVVPVPNVDFAQFYEEIAFDGQP----CQVVGW----NNGTATPVQQFINAPILNRDTCNGLA 201

  Fly   181 TYLRQLPETTMCL-LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRA-APDGYERVSKLRN 243
            .:|..:.|:.:|. :.....|.|..:.|.....:|:|.|:.|..: |||:| .|..|.::.....
Mosquito   202 VHLGNIRESMVCAGVTNAGPGVCASNLGTGLFCEGRLAGILSTGL-GCGQANNPGVYTQIRYYLP 265

  Fly   244 WIAEKAS 250
            ||.|:.|
Mosquito   266 WIREQFS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/235 (29%)
Tryp_SPc 28..248 CDD:238113 69/237 (29%)
AgaP_AGAP006486XP_316523.4 Tryp_SPc 41..270 CDD:238113 69/237 (29%)
Tryp_SPc 41..267 CDD:214473 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.