DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and SP24D_ANOGA

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_316450.1 Gene:SP24D_ANOGA / 1277027 VectorBaseID:AGAP006416 Length:271 Species:Anopheles gambiae


Alignment Length:261 Identity:111/261 - (42%)
Similarity:146/261 - (55%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLA-----------QNDSVVEP-------------RIVGGTKAREGQFPHQISLRRRG 49
            |.|.|...||           |||  |.|             |||||:.|.|||||||::|.|..
Mosquito     9 LALAALAYLALVSGVRFHLSEQND--VLPGGSQARRPFFQGARIVGGSVASEGQFPHQVALLRGN 71

  Fly    50 SHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGH 114
            :.|||||:|...:|:||||||..|..|.||:.:.:.|||:.||: |||..||.|..|..|.:..:
Mosquito    72 ALTCGGSLIESRWVLTAAHCVYNGALVVPASSIVVVAGSVSLSN-GVRRAVARVIPHERYGNFKN 135

  Fly   115 DVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQ 179
            |||:|:|:.||..::.|..|.|.|...|..:.|.|||||.:.|.||:||.|.|.:...::.:.|:
Mosquito   136 DVALLQLQLSLPSSAYIRPIALRTTSVPAGSEVVISGWGRMYQGGPVSNMLRYNRATVVADQQCR 200

  Fly   180 KTYLRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNW 244
            ..  ..:....:|...|.:.|||.|||||||....:|||:|:|:|..||.|:||||.|||....|
Mosquito   201 MA--TGISTGLICFTSPVNNGACNGDSGGPAILNNQLVGVANFIINYCGSASPDGYARVSDFVTW 263

  Fly   245 I 245
            |
Mosquito   264 I 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 99/217 (46%)
Tryp_SPc 28..248 CDD:238113 100/218 (46%)
SP24D_ANOGAXP_316450.1 Tryp_SPc 49..264 CDD:214473 99/217 (46%)
Tryp_SPc 50..267 CDD:238113 100/218 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H114140
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D121264at33392
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - mtm9574
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.