DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP006385

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_316419.4 Gene:AgaP_AGAP006385 / 1276997 VectorBaseID:AGAP006385 Length:260 Species:Anopheles gambiae


Alignment Length:257 Identity:78/257 - (30%)
Similarity:128/257 - (49%) Gaps:31/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAAGVLAQNDSVVEP------RIVGGTKAREGQFPHQISLRRRGSH----TCGGSIISKDYVVTA 66
            ||..:||...||.:.      |:|.|..|:.||||:|:.|.....:    .||||::::::|:||
Mosquito     6 CALALLALVASVAQAAPRGGMRVVNGETAKLGQFPYQVRLTLHVGNGQQALCGGSLLNEEWVLTA 70

  Fly    67 AHCVKQGNNVAPANELEIQAGSLLLS----SGGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSL 125
            .|||..      |..:|:..|::..|    .|.:.:.......|..||.  ..:|||:::|.:.:
Mosquito    71 GHCVML------AKSVEVHLGAVDFSDNTNDGRLVLESTEFFKHEKYNPLFVANDVALVKLPSKV 129

  Fly   126 TFNSNIAAIKLATEDPP-NDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQL-PE 188
            .|:..:..::|.|.|.. ....|.:||||.:...|.::..|.|..:|.:..:.||||:...| .:
Mosquito   130 EFSERVQPVRLPTGDEDFAGREVVVSGWGLMVNGGQVAQELQYATLKVIPNKQCQKTFSPLLVRK 194

  Fly   189 TTMCLLHPKDKGACYGDSGGPATY--QGKLVGLASFVIG---GCGRAAPDGYERVSKLRNWI 245
            :|:|.:..:.:..|.||||||...  ...|||:.||  |   ||.:..|..:.||:..|:|:
Mosquito   195 STLCAVGEELRSPCNGDSGGPLVLAEDKTLVGVVSF--GHAQGCDKGHPAAFARVTAFRDWV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/234 (30%)
Tryp_SPc 28..248 CDD:238113 71/235 (30%)
AgaP_AGAP006385XP_316419.4 Tryp_SPc 27..254 CDD:214473 71/234 (30%)
Tryp_SPc 28..257 CDD:238113 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.