DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP005707

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_315716.4 Gene:AgaP_AGAP005707 / 1276376 VectorBaseID:AGAP005707 Length:299 Species:Anopheles gambiae


Alignment Length:257 Identity:75/257 - (29%)
Similarity:117/257 - (45%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NDSVVEPRIVGGTKAREGQFPHQISLRRRGSHT---CGGSIISKDYVVTAAHCVKQGNNVAPANE 81
            :|.|...||..|..|...|||..:.:...||.:   |.|.:||..:|:|||.|      ::.:|.
Mosquito    54 DDQVRSSRISDGQIATATQFPWAVGVLISGSSSHSFCSGVLISPRFVLTAAVC------ISGSNT 112

  Fly    82 LEIQAGSLLLSSGGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSLTFNSNIAAIKLAT-EDPPN 143
            |.|..|:..::.....:.|:.:..||||:|  |..|:|:|.|.:.....:.|..|.|.. .|..|
Mosquito   113 LTILLGASDMTRVEEFIGVSNILSHPNYSSFFNRDDIAILTLSSPAPIRNTIRPIDLPRWSDVGN 177

  Fly   144 D-----ATVDISGWGAISQRG----PISNSLLYVQVKALSRE---SCQKTYLRQLPETTMCLLHP 196
            :     ||.  :|||...:|.    ||.|  |:..|.:::..   ....|::|   :|.:| ...
Mosquito   178 NFNNWAATT--AGWGNTGRRENEPIPIPN--LHFAVDSVNSNFVCGLSHTFIR---DTHIC-TST 234

  Fly   197 KDKGACYGDSGGPATY--QGK--LVGLASF---VIGGCGRAAPDGYERVSKLRNWIAEKASL 251
            .:.|.|.||.|||.|.  .|:  |||:.||   .:.||.|.....:.|:::...||.:...:
Mosquito   235 DNGGPCNGDEGGPVTVTESGRTFLVGIHSFHYSGLFGCDRGRSAVHTRITEYLGWIQDNTDV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/242 (29%)
Tryp_SPc 28..248 CDD:238113 72/244 (30%)
AgaP_AGAP005707XP_315716.4 Tryp_SPc 61..290 CDD:214473 71/242 (29%)
Tryp_SPc 62..293 CDD:238113 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.