DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP005664

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_315684.2 Gene:AgaP_AGAP005664 / 1276347 VectorBaseID:AGAP005664 Length:306 Species:Anopheles gambiae


Alignment Length:248 Identity:77/248 - (31%)
Similarity:115/248 - (46%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRR---GSHTCGGSIISKDYVVTAAHCVKQG--------------- 73
            |:|.|.:|..||||:||:|...   |:..||||:::.:||:||||||..|               
Mosquito    60 RVVNGQEATPGQFPYQIALLSNFLIGTGLCGGSVLTNNYVLTAAHCVIMGTSTVALGGNAIMGAH 124

  Fly    74 NNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKL 136
            |..||....:|    :..:|.|       ::.||.|:|..  :|:||:||.:.:||...|...:|
Mosquito   125 NRDAPEPSQQI----IAFTSAG-------ISAHPGYSSANIRNDIAVVRLNSPITFTDRIQPARL 178

  Fly   137 ATEDPPND---ATVDISGWGAISQRGPISNS-LLYVQVKALSRESCQKTYLRQLPE-TTMCLLHP 196
            ........   .|..:||:|..|.....::| :::.....::...|...:...|.| ..:|:...
Mosquito   179 PARSDTRQFGGFTGTVSGFGRTSDASQATSSVVMFTSNPVMTNADCIAQWNAVLIEPQNVCMSGE 243

  Fly   197 KDKGACYGDSGGPATYQ--GKL-VGLASF-VIGGCGRAAPDGYERVSKLRNWI 245
            ..:.||.||||||...|  |.| ||:.|| ...||....|..|.|||...::|
Mosquito   244 GGRSACNGDSGGPLAVQDGGSLQVGVVSFGSAAGCAIGMPSVYARVSFFLDFI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/246 (31%)
Tryp_SPc 28..248 CDD:238113 76/247 (31%)
AgaP_AGAP005664XP_315684.2 Tryp_SPc 60..296 CDD:214473 76/246 (31%)
Tryp_SPc 61..299 CDD:238113 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.