DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP005594

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_315604.2 Gene:AgaP_AGAP005594 / 1276280 VectorBaseID:AGAP005594 Length:294 Species:Anopheles gambiae


Alignment Length:239 Identity:51/239 - (21%)
Similarity:93/239 - (38%) Gaps:38/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GTKAREGQFPHQISLR---RRGSHTCGGSIISKDYVVTAA----HCVKQGNNVAPANELEIQAGS 88
            |..|..||||:...:.   ....:...|::|:.:||:|.|    |....|:.:..    .|..||
Mosquito    60 GYNAYAGQFPYHAEINFYTNNYLYKRAGALITLNYVITPASSFHHYFIHGDMLYG----YITLGS 120

  Fly    89 LLLSS----GGVRVPVATVTVHPNY---NSNGHDVAVLRLRNSLTFNSNIAAIKL-ATEDPPNDA 145
            :..|:    ..:....:::.:||.:   |.:.:::|::||.........:..|:| ...|.....
Mosquito   121 VFNSTTQWEQTINYTESSIVMHPFFHYTNEDYYNIAIIRLDRPAIQTRYVKPIRLPKLSDTRTYL 185

  Fly   146 TVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTM-----CLLHPKDKGACYGD 205
            .::.:..|...:.|     |.|::...||...|:    :||...|.     |....:....|...
Mosquito   186 AMEGTSCGTTKEEG-----LSYLRNPLLSLSICR----QQLTSYTFHDQHYCTDVYRGGSFCNRQ 241

  Fly   206 SGGPATYQGK----LVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            .|...|.:.:    |:|:...:. .|..:.|..|.|:|..|.||
Mosquito   242 CGSSLTVEDENGPVLIGVVDLLF-QCSYSYPVRYVRLSAFREWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 49/237 (21%)
Tryp_SPc 28..248 CDD:238113 51/239 (21%)
AgaP_AGAP005594XP_315604.2 Tryp_SPc 60..285 CDD:304450 51/239 (21%)
Tryp_SPc 60..284 CDD:214473 49/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.