DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP005591

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_315601.4 Gene:AgaP_AGAP005591 / 1276277 VectorBaseID:AGAP005591 Length:273 Species:Anopheles gambiae


Alignment Length:248 Identity:63/248 - (25%)
Similarity:103/248 - (41%) Gaps:49/248 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PRIVGGTKAREGQFPHQISLRRRGS-----HTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQ 85
            |....|..|..||||:..:||.:..     :||.||:|:..|::|.|.||.. |:|..|..:   
Mosquito    37 PLATDGYLAYPGQFPYHAALRFKTKSSTKVYTCAGSLITPVYILTTAACVNH-NSVEYAFAI--- 97

  Fly    86 AGSLLLSSGG------VRVPVATVTVHPNYNSNGH-DVAVLRLRNSLTFNSNIAAIKL------- 136
            .|||.  :|.      :.:.:..:.:||..:..|| |:|.:.:.:..|.|..:..|:|       
Mosquito    98 LGSLF--NGNTEWEQHINITMNGIRIHPPSSMYGHNDIATIHMDHPATLNEYVQPIRLPRLSDTR 160

  Fly   137 ATEDPPNDATVDISGWGAISQRGPI-SNSLLYVQVKAL----SRESCQKTYLRQLPETTMCLLHP 196
            ..|.....||..::|.|....|..: ||:..:..::.|    |:..|..||:             
Mosquito   161 TYEMMEGTATSALNGDGLRYLRNQVMSNADCHEAIQPLYNISSQHICTDTYI------------- 212

  Fly   197 KDKGACYGDSGGPATYQGK----LVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
             ....|...:|...|.:.:    |||:.:.:: .|....|..:.|||..|.||
Mosquito   213 -GGSLCGRTTGSALTVEDENGRMLVGVGNLIV-LCDLHYPIRHIRVSYFREWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 60/245 (24%)
Tryp_SPc 28..248 CDD:238113 62/246 (25%)
AgaP_AGAP005591XP_315601.4 Tryp_SPc 42..264 CDD:238113 62/243 (26%)
Tryp_SPc 42..263 CDD:214473 60/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.