DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP004858

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_314333.4 Gene:AgaP_AGAP004858 / 1275108 VectorBaseID:AGAP004858 Length:435 Species:Anopheles gambiae


Alignment Length:221 Identity:63/221 - (28%)
Similarity:99/221 - (44%) Gaps:31/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSG--------GVRVPVATVTVH 106
            |..||||:|:..:|:|||||....:.|||.   .::.|.:.:::|        .....:::...|
Mosquito    14 SFDCGGSLITPRHVLTAAHCALNDDGVAPQ---VVRLGVIDITAGLYDPQNQFAQEYGISSFRRH 75

  Fly   107 P--NYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQ 169
            |  .:.:..||:.::.|...:|....:....|.|........::..|:|..|..|..:..||.||
Mosquito    76 PEHEFRAEYHDIGLVTLDRPVTLTDAVVPACLWTGAQVPLRRLEAVGFGQTSFGGERTPILLKVQ 140

  Fly   170 VKALSRESCQKTY-----LRQ-LPETTMCLLHPKDKGACYGDSGGPATYQGKLVG---LASFVIG 225
            :..:...:|.:.|     .|| |.:..||....: ...|:||||||  .|.||:.   |..||:|
Mosquito   141 LSPVDNSACGRFYPPSRRRRQGLIDQQMCASDER-MDTCHGDSGGP--LQLKLMANNRLIPFVVG 202

  Fly   226 ------GCGRAAPDGYERVSKLRNWI 245
                  .||.|.|..|.|||...:|:
Mosquito   203 ITSFGRFCGTATPAVYTRVSSYVDWL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 62/219 (28%)
Tryp_SPc 28..248 CDD:238113 63/221 (29%)
AgaP_AGAP004858XP_314333.4 Tryp_SPc 1..229 CDD:238113 63/221 (29%)
Tryp_SPc 1..227 CDD:214473 62/218 (28%)
Tryp_SPc 295..>384 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.