DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP005195

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_314094.4 Gene:AgaP_AGAP005195 / 1274901 VectorBaseID:AGAP005195 Length:250 Species:Anopheles gambiae


Alignment Length:252 Identity:75/252 - (29%)
Similarity:127/252 - (50%) Gaps:12/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQNDSVVEP--RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTA 66
            |.:.::.|....|.:...|.|||  .|:||:...:.:.|:.:|: ...|..||||||:..:::||
Mosquito     2 FLSGIVPLVLLVVHSLEASPVEPLAPIIGGSNVEDKKVPYLVSI-TVNSFVCGGSIIADRWILTA 65

  Fly    67 AHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNY--NSNGHDVAVLRLRNSLTFNS 129
            |||||:  |:.....:.::..:  .::.|....:.....|..|  .:...||.:||||:.|.|..
Mosquito    66 AHCVKR--NMVKNAAVRVETNN--FTASGTLYRIDRAIAHEKYFRGAFRDDVGLLRLRSPLKFGE 126

  Fly   130 NIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLL 194
            .:..|:|.::..|.:||:.:.|.|.||:....:.....::.|.::.:.|:|.....:....:|..
Mosquito   127 RVKKIELLSQIVPYNATLTLVGRGYISKDNKTTKITQMIKAKNIALKLCRKMQPDFIYPGHLCTF 191

  Fly   195 HPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKASL 251
            ..|.||.|.||||||..:.|:.||:.|: ..|||....|.:.|:|....||  ||::
Mosquito   192 VKKGKGTCSGDSGGPVVWYGRQVGIVSW-SKGCGAGYFDVHSRISYFLPWI--KATI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 64/219 (29%)
Tryp_SPc 28..248 CDD:238113 66/221 (30%)
AgaP_AGAP005195XP_314094.4 Tryp_SPc 28..244 CDD:238113 67/223 (30%)
Tryp_SPc 28..241 CDD:214473 64/218 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.