DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP004149

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_313033.3 Gene:AgaP_AGAP004149 / 1273976 VectorBaseID:AGAP004149 Length:543 Species:Anopheles gambiae


Alignment Length:294 Identity:76/294 - (25%)
Similarity:121/294 - (41%) Gaps:54/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPFWTSLLVLCAAGVLAQNDSV--------VEPRIVGGTKAREGQFPHQISLRRRG------SHT 52
            :|..|.||......|:.....:        |..||:||.....||||....|..|.      ::.
Mosquito   248 IPTTTELLTTVLPTVVPDQPMINAPLCGLSVNTRIIGGETEVPGQFPWMARLAYRNQTSGRVTYR 312

  Fly    53 CGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVP----------VATVTVHP 107
            |.||:|:..:|:|.||||.  |.:.....:.|:.|.  |....|..|          :..:..|.
Mosquito   313 CAGSLITNRHVITVAHCVT--NLIDELQLVSIRLGD--LECNAVTDPRCSARYQDFAIEQIIPHE 373

  Fly   108 NYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATED-PPNDATVD-----ISGWGAISQRGPI-SN 163
            :|:  ...:|:|:::||.:....:.|:.:.|.|:. .|....:.     |:|||:.|.|... |.
Mosquito   374 SYDVPKYANDIALIKLRETTETYNIISPLCLPTDQYAPYALNLTGQLGIIAGWGSTSNRSNTPSP 438

  Fly   164 SLLYVQVKALSRESCQKTYLRQ---------LPETTMCLLHPKDKGACYGDSGGPATYQG----- 214
            :|.::::..:....|...|.|.         :....||....:::.||.||||||...:.     
Mosquito   439 TLQWLRLPIVDTAGCANAYARYSVNSRNPIIVSGNQMCAQGQENRDACQGDSGGPLMNEAISTRD 503

  Fly   215 --KLVGLASFVIGGCGRA-APDGYERVSKLRNWI 245
              .|:||.||....||.: .|..|.|:|...:||
Mosquito   504 RFVLLGLVSFGPRTCGVSNFPGVYTRISAYIDWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 68/259 (26%)
Tryp_SPc 28..248 CDD:238113 69/260 (27%)
AgaP_AGAP004149XP_313033.3 CLIP 47..92 CDD:288855
Tryp_SPc 281..537 CDD:214473 68/259 (26%)
Tryp_SPc 282..537 CDD:238113 67/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.