DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CLIPB2

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_312956.3 Gene:CLIPB2 / 1273920 VectorBaseID:AGAP003246 Length:355 Species:Anopheles gambiae


Alignment Length:284 Identity:79/284 - (27%)
Similarity:123/284 - (43%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQNDSV---------VEPRIVGGTKAREGQFPHQ--ISLRRRGSH---TCGGSIIS 59
            ||.||:....:..|.         |..||:||......:||..  |..|:.|:.   .|||::|:
Mosquito    75 LVCCASEQQTRTSSFPTSPECGIQVTDRIIGGQTTELEEFPWTALIEYRKPGNQYDFHCGGALIN 139

  Fly    60 KDYVVTAAHCVK------QGNNV-------APANELEIQAGSLLLSSGGVRVPVATVTVHPNYN- 110
            ..|::||||||:      |.|.|       :.||:    ....:.|:|.:.:.:.:...|..|: 
Mosquito   140 ARYILTAAHCVQSLPRGWQLNGVRLGEWDLSTAND----CSDGICSAGPIDLEIESFVAHAGYDA 200

  Fly   111 ---SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPND----ATVDI-SGWGAISQRGPISNSLLY 167
               ::.:|:|::|||..:..:..|..|.|...:|...    .||.. :|||. ::....|...|.
Mosquito   201 ADTAHTNDIALIRLRQDVASSEMIRPICLPLTEPQRSRNRVGTVSFAAGWGK-TESASASERKLK 264

  Fly   168 VQVKALSRESCQKTYLR---QLPETTMCLLHPKDKGACYGDSGGP-------ATYQGKLVGLASF 222
            |::.......|::.|..   .|..:.||....:.|..|.||||||       |.|   |:|:.||
Mosquito   265 VELTVQDPSRCRQIYRGINIALKASQMCAGGLQGKDTCTGDSGGPLMAKSAGAWY---LIGVVSF 326

  Fly   223 VIGGCGRAA-PDGYERVSKLRNWI 245
            .:..||.|. |..|..|.:..:||
Mosquito   327 GLSKCGTAGYPGVYTNVVEYLDWI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/255 (28%)
Tryp_SPc 28..248 CDD:238113 72/256 (28%)
CLIPB2XP_312956.3 CLIP 26..78 CDD:288855 2/2 (100%)
Tryp_SPc 102..350 CDD:214473 71/255 (28%)
Tryp_SPc 103..353 CDD:238113 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.