DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP002432

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_312513.5 Gene:AgaP_AGAP002432 / 1273529 VectorBaseID:AGAP002432 Length:318 Species:Anopheles gambiae


Alignment Length:249 Identity:81/249 - (32%)
Similarity:114/249 - (45%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLR---RRGSHTCGGSIISKDYVVTAAHC----------VKQGNNVAP 78
            |||.|.:||.||||:|::|.   ..|...||.|||::.||:|||||          |..|..:..
Mosquito    67 RIVNGQEARPGQFPYQVALLGQFNAGVGLCGASIITQRYVLTAAHCVYTGVDASAPVANGTAILG 131

  Fly    79 ANELEIQAGS---LLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKL-A 137
            |:...|:..|   :..||.|       |..||.|:  ...:|:||:||...:.:...|..|:| :
Mosquito   132 AHNRMIEEPSQQRITFSSSG-------VIGHPGYDLFDVRNDIAVVRLDELIVYTDRIQPIRLPS 189

  Fly   138 TEDPPNDATV--DISGWGAISQRGP-ISNSLLYVQVKALSRESCQKTY--LRQLPET-TMCLLHP 196
            ..|....|.:  .:||:|..|...| :|:.|.||....::...|:..:  |..|.|. .:|....
Mosquito   190 RSDTRTFAGLMGTVSGYGIYSTANPALSDVLNYVLNPVMTNADCRAGWSGLEWLIEAQNICQSGD 254

  Fly   197 KDKGACYGDSGGPATYQGK----LVGLASFVIG-GCGRAAPDGYERVSKLRNWI 245
            ..:.||..|||||.|.|..    .||:.||... ||....|..:.||:....||
Mosquito   255 GGRAACNSDSGGPLTVQDSGESLQVGVVSFGSSVGCDNGVPTVFARVTYYLEWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 79/247 (32%)
Tryp_SPc 28..248 CDD:238113 80/248 (32%)
AgaP_AGAP002432XP_312513.5 Tryp_SPc 67..308 CDD:214473 79/247 (32%)
Tryp_SPc 68..311 CDD:238113 80/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.