DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CLIPA8

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_311445.2 Gene:CLIPA8 / 1272532 VectorBaseID:AGAP010731 Length:369 Species:Anopheles gambiae


Alignment Length:238 Identity:60/238 - (25%)
Similarity:108/238 - (45%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TKAREGQFPHQISL--------RRRGSHTCGGSIISKDYVVTAAHCV-KQGNNVAPANELEIQAG 87
            |.|:.|:||..:::        .::.::..||::|...:||||||.. |..|.||...|.::...
Mosquito   125 TYAQYGEFPWVVAILEAFYSSNEQQFTYVGGGTLIHPRFVVTAAHIFNKTENLVASFGEWDMNRD 189

  Fly    88 SLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDIS 150
            ..:.....:.:. .|:.|||.|||.|  :|:|:.:|:.::.::.:|..|.|.......|..:.||
Mosquito   190 ENVYPKQNIDID-RTIIVHPEYNSVGLLNDIALAQLKQNVVYDKHIRPICLPNPTDRFDDQLCIS 253

  Fly   151 -GWGAISQRGPISNSLLYVQVKALSRESCQKTYLR-------QLPETTMCLLHPKDKGACYGDSG 207
             |||..:.....:|.|..|.:..::|.||:|.:..       :|.::.:|....:....|.||.|
Mosquito   254 TGWGIEALTSAYANVLKRVDLPVIARASCKKLFAETRLGPFFRLHKSVLCAGGEEGADMCDGDGG 318

  Fly   208 GPATYQGK-----LVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            .......:     |.|:.|:.:....:..|..|..|::...||
Mosquito   319 SGLACPNESGAYVLAGIVSWGLSCHQQNVPGAYVNVARFVTWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 58/236 (25%)
Tryp_SPc 28..248 CDD:238113 60/238 (25%)
CLIPA8XP_311445.2 Tryp_SPc 127..364 CDD:238113 59/236 (25%)
Tryp_SPc 127..361 CDD:214473 57/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.