DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP010730

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_311444.4 Gene:AgaP_AGAP010730 / 1272531 VectorBaseID:AGAP010730 Length:256 Species:Anopheles gambiae


Alignment Length:253 Identity:65/253 - (25%)
Similarity:105/253 - (41%) Gaps:49/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TKAREGQFP---HQISLRRR----GSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSL 89
            |.::..::|   :.::|:::    |...|||::|....|||.||      |.....:|..:.|..
Mosquito     1 TLSQYAEYPWVVYILALKKQEANSGDFVCGGTLIHSRLVVTTAH------NTDGKTDLVARFGEW 59

  Fly    90 LLSSGGVRVP-----------VATVTVHPNY--NSNGHDVAVLRLRNSLTFNSNIAAIKLATEDP 141
            .:|:.....|           ||.|..||.|  |...:|:|:|.|..::.:.::|..|.|   ..
Mosquito    60 DISTTKEPFPQQCLFPHQDIDVAEVIKHPQYVFNPIQNDIALLVLAENVQYAAHIRPICL---PQ 121

  Fly   142 PNDATVD----ISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLR--------QLPETTMCLL 194
            |.|..|.    .:|||  .:||..:|.:..:.:..:.|.:|.: .||        .|.|..:|..
Mosquito   122 PTDEFVGQRCVSNGWG--KERGVYANVMKKLTLPVIGRANCTR-MLRYAGLGPFYTLREGFLCAG 183

  Fly   195 HPKDKGACYGDSGGPATYQGK-----LVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            .......|.||.|.|...|.:     |.|:.|:.||..|...|..|..|::...|:.|
Mosquito   184 GEVAVDMCKGDGGSPLACQTESGTYVLAGIVSWGIGCGGFNTPGVYVAVNRYVQWLNE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 63/249 (25%)
Tryp_SPc 28..248 CDD:238113 65/253 (26%)
AgaP_AGAP010730XP_311444.4 Tryp_SPc 7..242 CDD:238113 64/247 (26%)
Tryp_SPc 7..238 CDD:214473 62/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.