DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP010659

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_311380.4 Gene:AgaP_AGAP010659 / 1272466 VectorBaseID:AGAP010659 Length:393 Species:Anopheles gambiae


Alignment Length:218 Identity:69/218 - (31%)
Similarity:106/218 - (48%) Gaps:10/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |||.|..|....:|:.:.||...:..||.|||:..:|.|||||:.:..|  ||: :.:..||...
Mosquito     8 RIVNGKNANIASYPYIVRLRVNSAGVCGASIITYTHVFTAAHCLYKNQN--PAS-ITLYGGSTSQ 69

  Fly    92 SSGGVRVPVATVTVHPNYNSNGH--DVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGA 154
            :||||....:.|.:||.||...|  |..:::::||.....|||.|.|...:.|:|.|...:|||.
Mosquito    70 TSGGVVFFASKVIIHPYYNPETHNYDAGIVQIKNSFQGYKNIAPIALQDVEVPSDTTCYAAGWGY 134

  Fly   155 IS-QRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVG 218
            .: .|....::|.|..::.:|.:.|...:........:|.....:...|.||||||.....||.|
Mosquito   135 NNYDRKTSPDNLQYATLQVISPQQCSAGWSSYATPQFICAQQNNNGDVCNGDSGGPFVCNDKLTG 199

  Fly   219 LASFVIGG--CGRAAPDGYERVS 239
            ..|:  ||  |....|..:.:::
Mosquito   200 ATSY--GGVACRGKLPSAFTKIT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/218 (32%)
Tryp_SPc 28..248 CDD:238113 68/217 (31%)
AgaP_AGAP010659XP_311380.4 Tryp_SPc 8..222 CDD:214473 69/218 (32%)
Tryp_SPc 9..222 CDD:238113 68/217 (31%)
Trypsin <239..379 CDD:278516
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.