DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CTR1_ANOGA

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_309033.2 Gene:CTR1_ANOGA / 1270348 VectorBaseID:AGAP006709 Length:259 Species:Anopheles gambiae


Alignment Length:250 Identity:92/250 - (36%)
Similarity:137/250 - (54%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGV--LAQNDSVVEPRIVGGTKAREGQFPHQISLRRRG-SHTCGGSIISKDYVVTAAHC 69
            |||:.||.|  |..:|:.|. |:|||..|:.|..|:|:||:..| .|.||||:::..:|:|||||
Mosquito    12 LLVVSAAKVTKLVLDDNYVN-RVVGGEVAKNGSAPYQVSLQVPGWGHNCGGSLLNDRWVLTAAHC 75

  Fly    70 VKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIA 132
            : .|:  || .:|.:..|:..|..||..:.|..:..|..||  ...:|:.::||...:.|:..:.
Mosquito    76 L-VGH--AP-GDLMVLVGTNSLKEGGELLKVDKLLYHSRYNLPRFHNDIGLVRLEQPVRFSELVQ 136

  Fly   133 AIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQK-------TYLRQLPETT 190
            :::.:.:..|.:|||.::|||..|..||....|..:.|..||.|.|.|       |.:..|    
Mosquito   137 SVEYSEKAVPANATVRLTGWGHTSANGPSPTLLQSLNVVTLSNEDCNKKGGDPGYTDVGHL---- 197

  Fly   191 MCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
             |.|....:|||.||||||..|:|||||:.:|.: .|....|||:.|||...:|:
Mosquito   198 -CTLTKTGEGACNGDSGGPLVYEGKLVGVVNFGV-PCALGYPDGFARVSYYHDWV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 82/227 (36%)
Tryp_SPc 28..248 CDD:238113 82/227 (36%)
CTR1_ANOGAXP_309033.2 Tryp_SPc 32..250 CDD:214473 82/227 (36%)
Tryp_SPc 33..253 CDD:238113 82/227 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.