DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP007165

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_308603.4 Gene:AgaP_AGAP007165 / 1269949 VectorBaseID:AGAP007165 Length:275 Species:Anopheles gambiae


Alignment Length:277 Identity:72/277 - (25%)
Similarity:112/277 - (40%) Gaps:51/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLCAAGVLAQ--NDSVVEPRIVGGTKAREGQFPHQ----ISLRRRGSHTCGGSIISKDYVVTAAH 68
            ||.||.::|.  |.|..|.....|..|..|||||.    :......:..|.|:::.:.:|||.|.
Mosquito    14 VLPAAEIVALHCNPSGSENVTANGRPAYAGQFPHHALLVVRFGEEETRHCSGALVDEKHVVTVAQ 78

  Fly    69 CVKQGNNVAPANELEIQAGSLLL---SSGGVRVPVATV--TVHPNYNSNG--HDVAVLRLRNSLT 126
            ||...::|      |:..||..|   .|...|.....|  ||...|::..  :||||:|..:.  
Mosquito    79 CVVGSSSV------EVHLGSNCLLADESDKFRYVFTAVEFTVRDGYDTETFVNDVAVVRFTDE-- 135

  Fly   127 FNSNIAAIKL-----------ATEDPPNDATVDISGWGAISQ-RGPISNSLLYVQVKALSRESCQ 179
                  |::|           |.||......|..||:|.:.. ....::.|.|:::..|..|:||
Mosquito   136 ------AVRLPPWVKPVRLPEADEDQYVGQEVVTSGYGLMDYGTDGAADGLQYMRLVVLELEACQ 194

  Fly   180 KTYLRQLPET-TMCLLHPKDKGACYGDSGGP-ATYQGK-----LVGLASFVIG---GCGRAAPDG 234
            ..:...:|.| ..|......:..|..|.|.| ...:|:     |:||.||  |   .|.:..|..
Mosquito   195 AEFDFVMPGTGRFCAQEADHERNCVSDVGSPLVRKEGRLQEYVLLGLTSF--GQKFACSQGNPGA 257

  Fly   235 YERVSKLRNWIAEKASL 251
            .:.:.:...|:.:..|:
Mosquito   258 LQEMREHATWVRDVLSM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 62/250 (25%)
Tryp_SPc 28..248 CDD:238113 63/252 (25%)
AgaP_AGAP007165XP_308603.4 Tryp_SPc 36..256 CDD:214473 61/235 (26%)
Tryp_SPc 36..256 CDD:238113 61/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.