DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Gzmbl3

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001316809.1 Gene:Gzmbl3 / 120766154 RGDID:2320502 Length:248 Species:Rattus norvegicus


Alignment Length:260 Identity:69/260 - (26%)
Similarity:120/260 - (46%) Gaps:39/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPH----QISLRRRGSHTCGGSIISKDYVVTAAH 68
            :|:|.....||......|  |:||.:|:....|:    ||.....||..|||.:|.:|:|:||||
  Rat     3 VLLLLLTVSLAPTTEAGE--IIGGHEAKPHSRPYMAYLQIMDEDSGSTMCGGFLIQEDFVLTAAH 65

  Fly    69 CVKQGNNVAPANELEIQAGSLLLSSGGVR--------VPVATVTVHPNYNSN--GHDVAVLRLRN 123
            |:  |:.:           ::.|.:..::        :||..:..||.|||.  .:|:.:|:|::
  Rat    66 CL--GSKI-----------TVTLGAHNIKEQEKMQQVIPVVKIIPHPAYNSKKYSNDIMLLKLKS 117

  Fly   124 SLTFNSNIAAIKLATED---PPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQ 185
            .......:..:.|...:   .|.| ..:::|||.:...|...:.|..|::.....:.|: ||.::
  Rat   118 KAKRTRAVKTLSLPRSNFKVKPGD-VCNVAGWGKLGPMGKFPDKLQEVELTVQEDQECE-TYFKK 180

  Fly   186 L--PETTMCLLHPKDKGACY-GDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            .  ....:|...||.|.|.: ||||||...:....|:.::  |....:||:.:.:||...:||.|
  Rat   181 AYNKANQICAGDPKIKRASFGGDSGGPLVCKKVAAGIVAY--GSKNGSAPEAFTKVSTFLSWIKE 243

  Fly   248  247
              Rat   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 61/237 (26%)
Tryp_SPc 28..248 CDD:238113 64/240 (27%)
Gzmbl3NP_001316809.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.