DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and LOC116411715

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031760387.1 Gene:LOC116411715 / 116411715 -ID:- Length:386 Species:Xenopus tropicalis


Alignment Length:248 Identity:73/248 - (29%)
Similarity:112/248 - (45%) Gaps:31/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLR----RRGSHTCGGSIISKDYVVTAAHCVK--QGNNVAPANELEIQ 85
            |||||..:..|::|..:|::    :..||.||||::::.:|:|||||.|  |......:..|...
 Frog    41 RIVGGQNSPPGKWPWMVSIQSPTGKEFSHLCGGSVLNEIWVLTAAHCFKHLQRKEETKSWRLVFG 105

  Fly    86 AGSLLLSSGGVRVPVATVTVHPN-YN--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATV 147
            |.:|.:....|::......:.|. ||  :..:|:.:|||...:.|...:......||....:...
 Frog   106 ANNLKVLESSVQIRKIKEVIQPKAYNPTTEANDITLLRLDKPIVFTDYVQPACFPTEFANVEKKT 170

  Fly   148 D--ISGWGAISQR-GPISNSLLYVQVKALSRESCQKT--YLRQLPETTMCLLHPKDKG---ACYG 204
            |  |:|||.:.:. |..|..|...:|..:..:.|...  |...:.|..:|..|  :||   :|.|
 Frog   171 DCYIAGWGVLDEESGEPSEILQEARVHQIDSKKCNSKDWYDGAIGEYNLCAGH--EKGGIDSCQG 233

  Fly   205 DSGGP--------ATYQGKLVGLASFVIGGCGRAAPDG-YERVSKLRNWIAEK 248
            |||||        .||  .:||:.|:. .||.|....| |........|||.|
 Frog   234 DSGGPLMCKTQKSRTY--AVVGITSWG-SGCARGKKPGVYTSTKYFIKWIASK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/243 (28%)
Tryp_SPc 28..248 CDD:238113 71/245 (29%)
LOC116411715XP_031760387.1 Tryp_SPc 41..280 CDD:214473 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.