DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and LOC116407686

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031749385.1 Gene:LOC116407686 / 116407686 -ID:- Length:403 Species:Xenopus tropicalis


Alignment Length:255 Identity:74/255 - (29%)
Similarity:115/255 - (45%) Gaps:51/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG 87
            :|...::||..::.|.:|.|:::|.:....||||:|:..:||:||||.  .:.:.|:| ..:.||
 Frog    31 LVSSGVMGGQDSQPGMWPWQVNIRSQSGGFCGGSLITSKWVVSAAHCC--DSTLTPSN-YTVYAG 92

  Fly    88 SLLLSS---GGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATV 147
            |..||.   ..|.:.|....:||||.:  ||.|:.::.|...|.|...||.:.|    |.:..|.
 Frog    93 SYNLSGTNPNEVSITVKNFIIHPNYTAAENGSDICLMELGTELNFTQYIAPVCL----PASGVTF 153

  Fly   148 D------ISGWGA----ISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHP--KD-- 198
            .      ::|||.    :|...|:  :|....|..:..:.|...|..          ||  ||  
 Frog   154 PTGLPCWVTGWGEPAFNVSLPSPV--TLQQESVPLIGSQDCNNYYAS----------HPYIKDDM 206

  Fly   199 ---------KGACYGDSGGPATY----QGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
                     ||:|.||||||...    :..|||:.||.:.......|:.|.|::...:||
 Frog   207 ICAGNVSGGKGSCQGDSGGPLVCAEADRWFLVGIVSFGLSCQQPNYPEVYGRINGFLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/249 (29%)
Tryp_SPc 28..248 CDD:238113 73/250 (29%)
LOC116407686XP_031749385.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.